PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004484.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 145aa    MW: 16086.6 Da    PI: 9.2615
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004484.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR126.12.9e-0893134244
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreee 44 
                              fY  YA+ +GF+vr+ ++kk  r+geit++   Cs+ g++ ++
  Itr_sc004484.1_g00003.1  93 FYTVYATITGFDVRRVTEKKD-RQGEITWKYALCSRAGFKLPT 134
                              9***************99887.8888************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.1E-593133IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MPYWAIQFGV HWGIALNVTH CSTEVHNAVM NRLHSVHMRL AVSASQFLLG VNDCADVTLV  60
LRRVHVGYTV CANLVQKGLR GTRFSTLEEG ITFYTVYATI TGFDVRRVTE KKDRQGEITW  120
KYALCSRAGF KLPTGEGSGV GVLLV